Thread Rating:
  • 0 Vote(s) - 0 Average
  • 1
  • 2
  • 3
  • 4
  • 5
srs of gym management system pdf download
#1

Gym Management System is an easy-to-use gym and health club membership management system. It helps you keep records of your members and their memberships, and allows easy communication between you and your members. Gym Master is also feature-packed, helping you in the management and growth of fitness club. This software is easy to use for gym and health club. This has membership management system which helps to keep records of members and their membership details

The software to be produced is on Gym Management System. Here there are 2 users. They are The Admin and the receptionist (gym instructor). Receptionist can add the details of a person who wish to join the gym. Their personal information including weight, height and phone number are collected. The receptionist also provides timings for that person, when he can come to the gym. As soon as that particular person arrives, his day of attendance will be marked by the receptionist. The receptionist can also note down the gym equipment he wishes to join.
Admin has more authority than the receptionist. He provides unique username and password for the receptionist. He also has the right to delete or modify it. He even has the authority to add the gym equipments to the software. He can also modify it. Finally when that person wishes to leave the gym, his/ her present weight and height will be compared to his old height and weight. He can even store the details of the medicine information which are in the gym warehouse. He can even buy it from other medical shop and can store in the database so that any information needed can be retrieved easily.
Reply

#2
Gym management system project is a desktop application which is implemented in VB platform. Gym management system VB Project tutorial and guide for developing code. Entity relationship(er) diagrams,Data flow diagram(dfd),Sequence diagram and software requirements specification (SRS) of Gym management system in report file. Download Gym management system desktop application project in VB with source code . VB project desktop mini and major project with source code. Synopsis of Gym management system available in project document. This source code import in vb for application development. Gym management system project source code for BE,Btech,mca,bca,engineering,bs cs,IT,software engineering final year students can submits source code in collage. This source code submitted by saphal v nath. Download Free Scripts,source Codes,Reviews and Much More. Gym management system Screen Shot. We have grate project collection of VB with source code.
Reply

#3
GymMaster is software designed to make it easy to maintain detailed records of your members and their memberships, book classes and trainers, process and track sales, and communicate en mass with the right members at the right time.

Designed to fit clubs of all sizes, this gym software is feature-packed. With a full booking system, point of sale, website integration, billing integration, a mobile app for staff and members, online booking for clients, and 24/7 door access control, GymMaster has all you need to more efficiently run your gym.
Reply

#4
Gym management system is an easy-to-use gym and health club membership management system. It helps you keep records of your members and their memberships, and allows easy communication between you and your members. Gym Management system is also feature-packed, helping you in the management and growth of your club.
Reply

#5
GymMaster is easy-to-use gym and health club membership management software. GymMaster is software designed to make it easy to maintain detailed records of your members and their memberships, book classes and trainers, process and track sales, and communicate en mass with the right members at the right time.
Reply

#6
srs of gym management system pdf download

srs of gym management system pdf download
Reply

#7
hi am vaishnavi i would like to get details on srs gym managementsystem pdf download.
Reply

#8
Xvgswghjnvchwkkelmmnnekkwmnfnfkdpdmshhebemxlxjusnsmdkcjcjmdkdjchwnmskxchhx
Reply



[-]
Quick Reply

Forum Jump:


Users browsing this thread:
3 Guest(s)

Powered By MyBB, © 2002-2024 iAndrew & Melroy van den Berg.