to get information about the topic circular convolution of different length sequences full report ppt and related topic refer the page link bellow

http://seminarsprojects.net/Thread-circular-convolution-of-two-finite-length-sequences-using-dft-and-idft

http://seminarsprojects.net/Thread-circular-convolution-of-two-sequences ....etc

[:=Read Full Message Here=:]

2-D DFT of two dimensional finite extent sequences.

2-D DFT and Convolution
The DFT can be computed with a fast algorithm and it is sometimes beneficial to do the convolution of two sequences A (M1 N1) and B (M2 N2) via point DFTs. Speed improvements are only possible if both sequences have large dimensions. Otherwise convolutions are better implemented via the convolution sum.

2-D Low-Pass Filtering of Images We will be interested in two ways of implementin ....etc

[:=Read Full Message Here=:]

To get full information or details of linear convolution of two sequences please have a look on the pages

http://seminarsprojects.net/Thread-circular-convolution-of-two-finite-length-sequences-using-dft-and-idft

http://seminarsprojects.net/Thread-circular-convolution-of-two-sequences

if you again feel trouble on linear convolution of two sequences please reply in that page and ask specific fields in linear convolution of two sequences ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

Abstract

Fourphase codes have been widely used in radar and communication areas, but the synthesis of Four phase codes with good merit factor is a nonlinear multivariable optimization problem, which is usually difficult to tackle. To get the solution of above problem many global optimization algorithms like genetic algorithm, simulated annealing, and tunneling algorithm were reported in the literature. However, there is no guarantee to get global optimum point. In this paper, a novel and efficient VLSI architecture is ....etc

[:=Read Full Message Here=:]

write a c program for calculating linear convolution using circular convolution ....etc

[:=Read Full Message Here=:]

Discovery of Periodic Patterns in Spatiotemporal Sequences- IEE TRANSACTIONS ON KNOWLEDGE AND DATA ENGINEERING, VOL. 19, NO.

java


Abstract
In many applications that track and analyze spatiotemporal data, movements obey periodic patterns; the objects follow the same routes (approximately) over regular time intervals. For example, people wake up at the same time and follow more or less the same route to their work everyday. The discovery of hidden periodic patterns in spatiotemporal data could unveil important information to th ....etc

[:=Read Full Message Here=:]

would you please inform me about the air entertaining properties of olefine sulphonates and potassium carbonate. ....etc

[:=Read Full Message Here=:]

Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
thx. pls send me Estimation of the Speeds of Moving Vehicles from Video Sequences ppt ....etc

[:=Read Full Message Here=:]