Aim:
To write a program to print Hello World in CORBA.

Algorithm:
Step 1: Start the process
Step 2: Create an idl class in a module Hello1and declare a
method sayHello().
Step 3: Create an implement class HelloImpl which extends
_HelloImplBase and import the module.
Step 4: Define the sayHello method and return the result.
Step 5: Define the client program named HelloClient which
imports the module
(i) Declare a static reference for interface Hello
(ii) Create and initialize the ORB and get the roo ....etc

[:=Read Full Message Here=:]

import java.applet.*;
import java.awt.*;
import java.awt.event.*;
import java.awt.Choice.*;
//
public class Awte extends Applet implements TextListener,ActionListener
{
int a,b,c;
String s;
TextField f1,f2,f3;
Label l1,l2,l3;
Button Add,Sub,Mul,Div;
public void init()
{
//setBackground(Color.green);
setForeground(Color.red);
l1=new Label(First number);
l2=new Label(Second number);
l3=new Label(Result);
f1=new TextField(10);
f2=new TextField(20);
f3=new T ....etc

[:=Read Full Message Here=:]

to construct adder subtractor using ic 7483 and to perform 4 bit adder subtractor

Introduction

To be able to perform arithmetic, you must first be familiar with numbers. Therefore, although we give a few helping examples, this article is not about binary numerals.

The main interactive circuit at the top of this page is an arithmetic circuit capable of performing both addition and subtraction on any two 4-bit binary numbers. The circuit has a Mode switch that allows you to choose between adding (M=0) and subtracting (M=1). To understand why t ....etc

[:=Read Full Message Here=:]

Aim:
To write a C# program to perform encryption and decryption of the given data.

Algorithm
ALGORITHM FOR ENCRYPTION:
Step 1: Declare the class as encrypt_class.
Step 2: Start the main function.
Step 3: Declare the variable str in string data type.
Step 4: Create the object for inbuild encryption
algorithm TripleDESCryptoServiceProvider.
Step 5: Create the data file using Filestream
class.
Step 6: Create the object for class cryptoStream.
Cryptostream is a class to invoke the
Encryotor algorithm ....etc

[:=Read Full Message Here=:]

i want program regarding java program for enquiring the pnr status using servlet ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]

Write a C Program to declare an array for 2 0 floats. Accept the values from the user sort the two arrays in descending order. Merge the two arrays into a new array and display the new array.
/* Build your program around this.. */
main()
{
int a, b, c;
float t;

/*declare an array for 2 0 floats*/
float aList1;
float aList2;
float aList;

/* Accept the values from the user */
/* 1 */
for (c=0; c++;c <20)
scanf(%f, alist1+c);
/* 2 */
for (c=0; c++;c <20)
scanf(%f, alist2+c);

/* sort the two a ....etc

[:=Read Full Message Here=:]

Aim:
To write a program in C# to perform conversion of dollars to rupees.
Algorithm:
ALGORITHM FOR COMPONENT.
Step 1: Create a namespace as currwithcomp.
Step 2: Create a class called currency as public.
Step 3: Inside the class declare the private variables x of type integer.
Step 4: Define a property variables x.
Step 5: In the property we have the get and set method.
Step 6: Get method is used to get the value form the user and set is used for
setting the user value to the original variables.
Step 7: De ....etc

[:=Read Full Message Here=:]

Vibram Five Fingers report,British Petroleum in the UK economy with a vital component. Media reports said the British oil dividend is an important source of UK pension funds. Since the Gulf of Mexico drilling platforms, Deep Horizon on April 20 triggered an explosion since the massive oil spill, the oil market capitalization fall by nearly one-third of the British.

Although Cameron and Barack Obama on several occasions previously discussed the environmental consequences of oil spill crisis,Five Fingers Shoes and political influence, but t ....etc

[:=Read Full Message Here=:]

According to reports, Twitter shares in the secondary market is very popular. Several sources, the Wall Street coach bags stock prices currently on Twitter about 7 U.S. dollars per share.

Twitter, after a stock split earlier this year, Twitter's outstanding shares to 2.25 billion shares. This means that Twitter's value in the secondary market to reach $ 1,575,000,000. Relative Facebook, Twitter is not a lot of people holding large shares early, but the coach bags sale
demand for the shares of Twitter is still strong. Market, even some fund ....etc

[:=Read Full Message Here=:]