Discovery of Periodic Patterns in Spatiotemporal Sequences- IEE TRANSACTIONS ON KNOWLEDGE AND DATA ENGINEERING, VOL. 19, NO.

java


Abstract
In many applications that track and analyze spatiotemporal data, movements obey periodic patterns; the objects follow the same routes (approximately) over regular time intervals. For example, people wake up at the same time and follow more or less the same route to their work everyday. The discovery of hidden periodic patterns in spatiotemporal data could unveil important information to th ....etc

[:=Read Full Message Here=:]

Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
thx. pls send me Estimation of the Speeds of Moving Vehicles from Video Sequences ppt ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

2-D DFT of two dimensional finite extent sequences.

2-D DFT and Convolution
The DFT can be computed with a fast algorithm and it is sometimes beneficial to do the convolution of two sequences A (M1 N1) and B (M2 N2) via point DFTs. Speed improvements are only possible if both sequences have large dimensions. Otherwise convolutions are better implemented via the convolution sum.

2-D Low-Pass Filtering of Images We will be interested in two ways of implementin ....etc

[:=Read Full Message Here=:]

Abstract Time stamped texts, or text sequences, are ubiquitous in real-world applications. Multiple text sequences are often related to each other by sharing common topics. The correlation among these sequences provides more meaningful and comprehensive clues for topic mining than those from each individual sequence. However, it is nontrivial to explore the correlation with the existence of asynchronism among multiple sequences, i.e., documents from different sequences about the same topic may have different time stamps. In this paper, we form ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]

Abstract

Fourphase codes have been widely used in radar and communication areas, but the synthesis of Four phase codes with good merit factor is a nonlinear multivariable optimization problem, which is usually difficult to tackle. To get the solution of above problem many global optimization algorithms like genetic algorithm, simulated annealing, and tunneling algorithm were reported in the literature. However, there is no guarantee to get global optimum point. In this paper, a novel and efficient VLSI architecture is ....etc

[:=Read Full Message Here=:]

OBJECT TRACKING IN VIDEO SEQUENCES

ABSTRACT

This gives an overview of Object tracking, the problem of estimating the
trajectory of an object in the image plane as it moves around a scene.. In this paper, we divide the tracking methods into three categories based on the use of object representations, namely, methods establishing point correspondence, methods using primitive geometric models, and methods using contour evolution. Note that all these classes require object detection at some point. Rec ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 6321538 ref NP_011615.1 Pcp1p
MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Sequence 2:
>sp P48740 MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo s ....etc

[:=Read Full Message Here=:]

to get information about the topic topic mining over asynchronous related topic refer the page link bellow

http://seminarsprojects.net/Thread-topic-mining-over-asynchronous-text-sequences ....etc

[:=Read Full Message Here=:]