|
| Thread / Post | Tags |
Title: To perform global alignment between the given sequences using EMBOSS tool
Page Link: To perform global alignment between the given sequences using EMBOSS tool -
Posted By: PATEL NAVAL RAMESHBAHI
Created at: Thursday 17th of August 2017 05:06:31 AM
| antenna alignment by using pc ppt,
perform the circular convolution of sequences 1 n 1 2 1 2 x2 n 2 4 2 1,
context diagram of topic mining over asynchronous text sequences,
tracking moving objects in video sequences ppt,
topic mining over asynchronous text sequences download,
circular convolution of two sequences using threads and c programming,
gd topics given by wipro,
|
Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc
[:=Read Full Message Here=:]
|
|
|
Title: To perform multiple sequence alignment between the given sequences using Clustalw2 t
Page Link: To perform multiple sequence alignment between the given sequences using Clustalw2 t -
Posted By: shariff
Created at: Thursday 17th of August 2017 05:57:49 AM
| kiln girth gear alignment procedure,
full seminor report on antenna alignment using pc,
object tracking in video sequences seminar report,
antenna alignment using pc seminar report,
find reading of the resistance of a given wire using a metre bridge and specific resistance,
antenna alignment system using pc,
for what purposes multigate gold is given to a patient,
|
Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc
[:=Read Full Message Here=:]
|
|
|
Title: 2-D DFT of two dimensional finite extent sequences
Page Link: 2-D DFT of two dimensional finite extent sequences -
Posted By: nav_rew
Created at: Thursday 17th of August 2017 05:12:20 AM
| finite state machine elevator verilog,
image steganography in frequency domain using dft matlab code,
8point dft twiddle factor calculation images,
dft 8 pt twiddle factor matrix,
image steganography in frequency domain using dft matlab,
authors who agrees about knowledge according to age on the extent performance,
topic mining over asynchronous text sequences project free download,
|
2-D DFT of two dimensional finite extent sequences.
2-D DFT and Convolution
The DFT can be computed with a fast algorithm and it is sometimes beneficial to do the convolution of two sequences A (M1 N1) and B (M2 N2) via point DFTs. Speed improvements are only possible if both sequences have large dimensions. Otherwise convolutions are better implemented via the convolution sum.
2-D Low-Pass Filtering of Images We will be interested in two ways of implementin ....etc
[:=Read Full Message Here=:]
|
|
|
|
|
Title: vhdl code for autocorrelation
Page Link: vhdl code for autocorrelation -
Posted By: vipinqw
Created at: Thursday 17th of August 2017 06:29:10 AM
| 2d autocorrelation matlab code,
autocorrelation in vhdl,
autocorrelation ecg matlab code s,
autocorrelation of gold code matlab code,
find heart rate from autocorrelation ecg matlab code,
short time autocorrelation matlab code for speech,
gender recognition using autocorrelation,
|
Pls provide me with vhdl codes for autocorrelation as soon as possible ....etc
[:=Read Full Message Here=:]
|
|
|
|
|
Title: estimation of the speeds of moving vehicles from video sequences ppt
Page Link: estimation of the speeds of moving vehicles from video sequences ppt -
Posted By: alokbehera
Created at: Thursday 17th of August 2017 06:21:32 AM
| ppts on induction motor v f control capable of high performance regulation with low speeds,
matlab code for object tracking on a video sequences using mean shift and feature based,
the ratio between the speeds of two trains is 7 8 if the second train runs 400kmts in 4hrs then the speed of first train is,
machine tool gearbox is to be designed for 9 speeds ppt,
estimation of defects based on defect decay model estimation of defects based on defect decay model estimation of defects bas,
download video for speed detection of moving vehicles speed detection of moving vehicles,
topic mining over asynchronous text sequences,
|
Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
thx. pls send me Estimation of the Speeds of Moving Vehicles from Video Sequences ppt ....etc
[:=Read Full Message Here=:]
|
Title: ppt on advantages and disadvantages of log periodic antenna
Page Link: ppt on advantages and disadvantages of log periodic antenna -
Posted By: soumya sarita
Created at: Thursday 05th of October 2017 04:39:39 AM
| related www ghris go ke ghris log in,
er diagram for call log and message log,
free download ppt of log periodic antenna,
project on pattern detection using web log data,
event log book,
architectrure diagram for minimum bandwidth reservation for periodic streams in real time wireless system,
2 wireless technology based system shutdown restart and log off using 8051 microcontroller,
|
please find me a ppt on advantages and disadvantages of log periodic antenna ....etc
[:=Read Full Message Here=:]
|
Title: Electrons in a Periodic Potential
Page Link: Electrons in a Periodic Potential -
Posted By: viswa
Created at: Thursday 17th of August 2017 05:27:43 AM
| bascics log periodic antenna ppt,
potential flow,
documentation of minimum bandwith reservation for periodic streams in wireless real time systems,
documentation for minimum bandwidth reservation for periodic streams in wireless real time systems,
based on the electrons seminar topics for 11th std,
2 source of bioelectric potential,
advantage of log periodic antenna ppt,
|
Electrons in a Periodic Potential
Energy Bands and Energy Gaps in a Periodic Potential
Metals, Insulators, and Semiconductors
Energy Bands and Fermi Surfaces in 2-D and 3-D Systems
Bloch s Theorem
Using Bloch s Theorem: The Kronig-Penney Model
Empty Lattice Bands and Simple Metals
Density of States for a Periodic Potential
E(k) and N(E) for d-electron Metals
Dynamics of Bloch Electrons in a Periodic Potential
Effective Mass of Electrons
Electrons and Holes
Electron Wavef ....etc
[:=Read Full Message Here=:]
|
|
|
|
|
Title: free download matlab code for gender recognition applications using autocorrelation
Page Link: free download matlab code for gender recognition applications using autocorrelation -
Posted By: Vijoyshankar
Created at: Thursday 17th of August 2017 05:48:47 AM
| autocorrelation vhdl code,
facial gender recognition using svm matlab code,
gender recognition source code matlab,
autocorrelation of gold code matlab code,
facial gender recognition using ga matlab code,
matlab source code for gender recognition,
gender recognition using autocorrelation,
|
ok. thanks very much. thanks very much.thanks very much.thanks very much.thanks very much. ....etc
[:=Read Full Message Here=:]
|
Title: log periodic antenna ppt
Page Link: log periodic antenna ppt -
Posted By: VENKYSANDEEP
Created at: Thursday 05th of October 2017 05:30:49 AM
| minimum bandwidth reservation for periodic streams in wireless real time system coding in forum,
download log periodic antenna free ppt,
minimum bandwidth reservation for periodic streams in wireless real time system,
http seminarprojects net t log periodic antenna ppt,
detection of pattern using web log data,
documentation for minimum bandwidth reservation for periodic streams in wireless real time systems,
periodic convolution of 2 discrete sequences,
|
plz give me a ppt explaining the log periodic antennas. ....etc
[:=Read Full Message Here=:]
|
Title: Discovery of Periodic Patterns in Spatiotemporal Sequences
Page Link: Discovery of Periodic Patterns in Spatiotemporal Sequences -
Posted By: km.masharaf
Created at: Thursday 17th of August 2017 06:06:35 AM
| ppt on efficient and accurate discovery of patterns in sequence data sets,
data flow diagram for efficient and accurate discovery of patterns in sequence datasets,
why the spatiotemporal electroencephalograms is used in brain computer,
efficient and accurate discovery of patterns in sequence data sets project,
ppts for spatiotemporal association mining,
disadvantages of topic mining over asynchronous text sequences,
minimum bandwidth reservation for periodic streams in wireless real time system,
|
Discovery of Periodic Patterns in Spatiotemporal Sequences- IEE TRANSACTIONS ON KNOWLEDGE AND DATA ENGINEERING, VOL. 19, NO.
java
Abstract
In many applications that track and analyze spatiotemporal data, movements obey periodic patterns; the objects follow the same routes (approximately) over regular time intervals. For example, people wake up at the same time and follow more or less the same route to their work everyday. The discovery of hidden periodic patterns in spatiotemporal data could unveil important information to th ....etc
[:=Read Full Message Here=:]
|