to get information about the topic speed detection camera full report ,ppt and related topic refer the page link bellow
http://seminarsprojects.net/Thread-speed-detection-of-moving-vehicle-using-speed-cameras-full-report

http://seminarsprojects.net/Thread-automatic-over-speed-detector

http://seminarsprojects.net/Thread-speed-detection-of-moving-vehicle-using-speed-cameras

http://seminarsprojects.net/Thread-speed-detection-of-moving-vehicle-using-speed-cameras--24700

http://seminarsprojects.net/Thread-speed-detection-using-microcontroller

....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]

Abstract
The advance of technology makes video acquisition devices better and less costly, thereby increasing the number of applications that can effectively utilize digital video. Compared to still images, video sequences provide more information about how objects and scenarios change over time. However, video needs more space for storage and wider bandwidth for transmission. Hence is raised the topic of video compression. The MPEG 4 compression standard suggests the usage of object planes. If the object planes are segmented correctly and th ....etc

[:=Read Full Message Here=:]

I need matlab code to detect moving objects from video for project purpose.
I need matlab code to detect moving objects from video for project purpose. ....etc

[:=Read Full Message Here=:]

ABSTRACT

Present work is a numerical study of the effect of welding speed on welding induced residual stress in TIG welding. The moving heat source was modelled as a Uniformly Distributed Circular Heat Flow in ANSYS Workbench 15.0 to get the longitudinal and transverse residual stresses which were validated with the experimental data from literature. A study was conducted with the help of the model to assess the influence of change in welding torch speed on residual stresses. The predicted effect of weld speed on residual stress is in good ag ....etc

[:=Read Full Message Here=:]

OBJECT TRACKING IN VIDEO SEQUENCES

ABSTRACT

This gives an overview of Object tracking, the problem of estimating the
trajectory of an object in the image plane as it moves around a scene.. In this paper, we divide the tracking methods into three categories based on the use of object representations, namely, methods establishing point correspondence, methods using primitive geometric models, and methods using contour evolution. Note that all these classes require object detection at some point. Rec ....etc

[:=Read Full Message Here=:]

hello sir,
I need project(privacy aware monitoring framework for continuously moving objects)source code in java immediately,can you please send the code as early as possible,my mail id is [email protected].
thanking you. ....etc

[:=Read Full Message Here=:]

2-D DFT of two dimensional finite extent sequences.

2-D DFT and Convolution
The DFT can be computed with a fast algorithm and it is sometimes beneficial to do the convolution of two sequences A (M1 N1) and B (M2 N2) via point DFTs. Speed improvements are only possible if both sequences have large dimensions. Otherwise convolutions are better implemented via the convolution sum.

2-D Low-Pass Filtering of Images We will be interested in two ways of implementin ....etc

[:=Read Full Message Here=:]

Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
Estimation of the Speeds of Moving Vehicles from Video Sequences ppt
thx. pls send me Estimation of the Speeds of Moving Vehicles from Video Sequences ppt ....etc

[:=Read Full Message Here=:]