Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

import java.applet.*;
import java.awt.*;
import java.awt.event.*;
import java.awt.Choice.*;
//
public class Awte extends Applet implements TextListener,ActionListener
{
int a,b,c;
String s;
TextField f1,f2,f3;
Label l1,l2,l3;
Button Add,Sub,Mul,Div;
public void init()
{
//setBackground(Color.green);
setForeground(Color.red);
l1=new Label(First number);
l2=new Label(Second number);
l3=new Label(Result);
f1=new TextField(10);
f2=new TextField(20);
f3=new T ....etc

[:=Read Full Message Here=:]

Performance Analysis of a Linux-based FTP Server

Linux over the past couple of years has matured to the point where it has been accepted as a viable platform for server applications. This transformation is due to its stability and support provided by a few companies. Currently it is being used by Internet Service Providers. Linux will be accepted for more serious applications only if it can handle heavy loads. This thesis analyzes the performance of Linux in one such application, the FTP server. Several experiments were conducted to d ....etc

[:=Read Full Message Here=:]

FTP server bounce attack


The motive
==========
You are a user on foreign.fr, IP address F.F.F.F, and want to retrieve
cryptographic source code from crypto.com in the US. The FTP server at
crypto.com is set up to allow your connection, but deny access to the crypto
sources because your source IP address is that of a non-US site . In any case, you
cannot directly retrieve what you want from crypto.com's server.
....etc

[:=Read Full Message Here=:]

to construct adder subtractor using ic 7483 and to perform 4 bit adder subtractor

Introduction

To be able to perform arithmetic, you must first be familiar with numbers. Therefore, although we give a few helping examples, this article is not about binary numerals.

The main interactive circuit at the top of this page is an arithmetic circuit capable of performing both addition and subtraction on any two 4-bit binary numbers. The circuit has a Mode switch that allows you to choose between adding (M=0) and subtracting (M=1). To understand why t ....etc

[:=Read Full Message Here=:]

Submitted By:
TARUN AGGARWAL
ARYA COLLEGE OF ENGINEERING & I.T.

ABSTRACT
File Transfer Protocol (FTP) is a standard network protocol used to copy a file from one host to another over a TCP/IP-based network, such as the Internet. FTP is built on a client-server architecture and utilizes separate control and data connections between the client and server. FTP users may authenticate themselves using a clear-text sign-in protocol but can connect anonymously if the server is configured to allow it.
Th ....etc

[:=Read Full Message Here=:]

45.Ans : A 
1853 - 1856 ലെ ക്രിമിയൻ യുദ്ധത്തെ പശ്ചാത്തലമാക്കി രചിച്ച പുസ്തകമാണ് യുദ്ധവും സമാധാനവും. ഗുരുദേവ് എന്നറിയപ്പെട്ടിരുന്നത് - രവീന്ദ്രനാഥ ടാഗോർ 1933 മുതൽ 1945 വരെ ജർമ്മനിയുടെ ചാൻസലറായിരുന്നു അഡോൾഫ് ഹിറ്റ്ലർ. � ....etc

[:=Read Full Message Here=:]

information about the al l-->
salient features of e-mail,URL.,contrast,google, yahoo ,Telnet Session,FTP

1. Explain the salient features of e-mail? Explain its working with the help of an example.

Soln: - Electronic mail, or e-mail (and mail) for short, is one of the most popular uses of the Internet. Once you have an e-mail account you can send an electronic message (sort of like a letter) to just about anyone else with an e-mail account so long as you know their e-mail address. The salient features of e-mail are: -
Dela ....etc

[:=Read Full Message Here=:]

to get information about the topic PROJECT REPORT ON FTP full report ,ppt and related topic refer the page link bellow
http://seminarsprojects.net/Thread-project-report-on-ftp

http://seminarsprojects.net/Thread-file-transfer-protocol ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]