Sequence 1:
>gi 6321538 ref NP_011615.1 Pcp1p
MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Sequence 2:
>sp P48740 MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo s ....etc

[:=Read Full Message Here=:]

Girth gears are large ring gears which are normally fitted to the outside of mills or kilns to provide the primary rotational drive. Used on a number of mining and process applications but are well known in heavy mineral processing such as copper, silver, gold, platinum and iron ore.
Girth Gears
Girth Gears
David Brown girth gears are applied in the mining, cement, minerals industries used in various types of horizontal mills, rotary dryers, rotary kilns and other gear ring applications in heavy processing.
Girth gears are large ring gears ....etc

[:=Read Full Message Here=:]

sir i m interested to learn and see the girth gear alignment of kiln and mill girth gear.





sir i m interested to learn and see the girth gear alignment of kiln and mill girth gear.


....etc

[:=Read Full Message Here=:]

Web Server for High Performance Biological Sequence Alignment Based on FPGA
An FPGA-based web server for biological sequence alignment is presented in this article. The FPGA cores used in this server are highly parameterisable, scalable, and platform-independent. Te main components of the web server are :
-an HTML based interface
-a MySQL database for holding the user queries and results.
-a library of FPGA configurations
-a host application servicing user requests
-an FPGA coprocessor which is used for the purpose of acceleratio ....etc

[:=Read Full Message Here=:]

Abstract;
In order to examine the validity of model at organic/metal interfaces, the position of the vacuum level of N,N'-bis(3-methylphenyl)-N,N'-diphenyl--4,4'-diamine (TPD) film formed on various metal substrates (Au, Cu, Ag, Mg and Ca) was measured as a function of the film-thickness by Kelvin probe method in ultrahigh vacuum (UHV). TPD is a typical hole-injecting material for organic electroluminescent devices. At all the interfaces, sharp shifts of the vacuum level were observed within 1 nm thickness. Further deposition of ....etc

[:=Read Full Message Here=:]

antenna alignment using pc seminar full report ....etc

[:=Read Full Message Here=:]

hi faisal firstly u have to specify the gear either spur or helical. eventhough both be gears backlash is measured by the same technique but the difference lies in acceptable backlash. for measuring the backlash u have to keep an equal working surface of both pinion and girth gear. then u can take a feelers gauge and keep the guage in the non working surface at the intermediate place not at the addendum or dedendum.acceptable backlash may be about 10 mm. the new girth gear should be having about 3.8 mm. this backlash varies from kiln to mills. ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

send me the ppt presentation of girth gear and its maintainance in rotary kiln and its working in rotary kiln with images and also ppt of rotary kiln size 60mtrs long and 4mtrs oin dia to [email protected] ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]