:heart::heart:

please send some iee main projects for ece 2012 with abstracts



....etc

[:=Read Full Message Here=:]

i want antenna alignment using pc seminar full report. ....etc

[:=Read Full Message Here=:]

Web Server for High Performance Biological Sequence Alignment Based on FPGA
An FPGA-based web server for biological sequence alignment is presented in this article. The FPGA cores used in this server are highly parameterisable, scalable, and platform-independent. Te main components of the web server are :
-an HTML based interface
-a MySQL database for holding the user queries and results.
-a library of FPGA configurations
-a host application servicing user requests
-an FPGA coprocessor which is used for the purpose of acceleratio ....etc

[:=Read Full Message Here=:]

Abstract;
In order to examine the validity of model at organic/metal interfaces, the position of the vacuum level of N,N'-bis(3-methylphenyl)-N,N'-diphenyl--4,4'-diamine (TPD) film formed on various metal substrates (Au, Cu, Ag, Mg and Ca) was measured as a function of the film-thickness by Kelvin probe method in ultrahigh vacuum (UHV). TPD is a typical hole-injecting material for organic electroluminescent devices. At all the interfaces, sharp shifts of the vacuum level were observed within 1 nm thickness. Further deposition of ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 150393488 ref YP_001316163.1 globin
MTTPYDIIGKEALYDMIDYFYTLVEKDERLNHLFPGDFAETSRKQKQFLTQFLGGPNIYTEEHGHPMLRKRHMDFTITEFERDAWLENMQTAINRAAFPQGVGDYLFERLRLTANHMVNS
Sequence 2:
>gi 57637203 gb AAW53991.1 protozoan/cyanobacterial globin family protein
MSIRQITFKCKNSCYIRYILMEHGDIMSKTPYELIGQKALYQMIDHFYQLVEKDSRINHLFPGDFKETSRKQKQFLTQFLGGPDLYTQEHGHPMLKRRHMEFTISEYERDAWLENMHTAIQHAELPAGVGDYLFERLRLTAHHMVNS
Theory:
The ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 6321538 ref NP_011615.1 Pcp1p
MSGVSSVMLGLRPATRIFFRSNISVSPSRTFVSYIGRSQSTSILKNAPNLEDNVTNLQKIIPKRFFSQTSILKSRWKPIFNEETTNRYVRLNRFQQYQQRSGGNPLGSMTILGLSLMAGIYFGSPYLFEHVPPFTYFKTHPKNLVYALLGINVAVFGLWQLPKCWRFLQKYMLLQKDYVTSKISIIGSAFSHQEFWHLGMNMLALWSFGTSLATMLGASNFFSLYMNSAIAGSLFSLWYPKLARLAIVGPSLGASGALFGVLGCFSYLFPHAKILLFVFPVPGGAWVAFLASVAWNAAGCALRWGSFDYAAHLGGSMMGVLYGWYISKAVEKQRQRRLQAAGRWF
Sequence 2:
>sp P48740 MASP1_HUMAN Mannan-binding lectin serine protease 1 OS=Homo s ....etc

[:=Read Full Message Here=:]

antenna alignment using pc seminar full report ....etc

[:=Read Full Message Here=:]

Sequence 1:
>gi 44955888 ref NP_976312.1 myoglobin
MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Sequence 2:
>gi 21359820 ref NP_038621.2 myoglobin
MGLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
Sequence 3:
>gi 11024650 ref NP_067599.1 myoglobin [Rattus ....etc

[:=Read Full Message Here=:]

different alignment test of drilling machine ppt


1. Flatness of clamping surface of base. (Refer Fig. 6.17).

The test is performed by placing a straight edge on two gauge blocks on the base plate in various positions and the error is noted down by inserting the feeler gauges. This error should not exceed 0.1/1000 mm clamping surface and the surface should be concave only.

2. Flatness of clamping surface of table.

This test is performed in the same manner as test (1), but ....etc

[:=Read Full Message Here=:]

please send the main view of the project and the abstract for the real time bluetooth communication with mobile robot ....etc

[:=Read Full Message Here=:]